DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Dic4

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:109/268 - (40%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 DKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIAS--GSKIRAWSVVRELGLFGLY 508
            :.:|.:|.|   ..||.|.........|::|||..:|:..:..|  |:..|..|:   .|..|.|
  Fly    15 EPEGLLPRW---WFGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVKRIHSL---KGYLGFY 73

  Fly   509 KGARACLLRDVPFSAIYFPTYAHTKAM-MADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTR 572
            .|..|.:||.:..:.|:|..|...|.| ..|:|.|   |..:..|.:||...::...|.|:|..|
  Fly    74 DGFSAAILRQMTSTNIHFIVYDTGKKMEYVDRDSY---LGKIILGCVAGACGSAFGIPTDLINVR 135

  Fly   573 LQVVARS---GQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQR---- 630
            :|...:.   .:..|..|:|...:|..|||.:|.:||.:..||:||......:..|::::.    
  Fly   136 MQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRK 200

  Fly   631 ---------LFYVDFGGTQPKGSEAHKITTPLEQA----------------AASVTTENVDHIGG 670
                     |.::...||....|   .||.||:..                .|||.......:|.
  Fly   201 NISVNDGLPLHFLTSLGTSIISS---AITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP 262

  Fly   671 YRAAVPLL 678
            ||..||.:
  Fly   263 YRGFVPTI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 0/1 (0%)
PTZ00169 358..631 CDD:240302 54/203 (27%)
Mito_carr 449..539 CDD:278578 27/92 (29%)
Mito_carr 544..633 CDD:278578 25/104 (24%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 67/254 (26%)
Mito_carr 26..100 CDD:278578 23/76 (30%)
Mito_carr 104..201 CDD:278578 27/99 (27%)
Mito_carr 211..292 CDD:278578 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.