DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Bmcp

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:294 Identity:80/294 - (27%)
Similarity:129/294 - (43%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRM--QNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLL 420
            |..|..|........:|||..|||:  |.|:......::.||...|.|.|:.|.||...||.|:.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

  Fly   421 PQLMGVAPEKAIKL----TVNDLVRDK--LTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKI 479
            |.::..|....||.    |:..|..::  |.::.|:...|:.:|....|||......||.:::|:
  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

  Fly   480 RLQVAGEIASGSKIRAW-SVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYN 543
            |:||.|:......:..: .:.:..|:.||::|......|.|..:::..|.|...|..:.:..| :
  Fly   140 RMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNAFG-D 203

  Fly   544 HPLTLLAAGAIAGVPAASLVTPADVIKTRLQ------------VVARSGQTTYTGVWDATKKIMA 596
            |......:..||.:.:|...||.|||:|||.            |.|.:....|:|..|...:.:.
  Fly   204 HVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIR 268

  Fly   597 EEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQR 630
            .||..|.:||......|..|...:..:|||.|::
  Fly   269 NEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 29/97 (30%)
PTZ00169 358..631 CDD:240302 80/294 (27%)
Mito_carr 449..539 CDD:278578 22/90 (24%)
Mito_carr 544..633 CDD:278578 28/99 (28%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/86 (31%)
Mito_carr <132..199 CDD:278578 16/66 (24%)
Mito_carr 204..303 CDD:278578 28/99 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.