DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and CG18418

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:290 Identity:80/290 - (27%)
Similarity:138/290 - (47%) Gaps:28/290 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 RFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLP 421
            :|.:|..:|.:...:|.|:||:|||||   ....:|...|:||::...||:::||.:.||.||..
  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQ---ISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSA 78

  Fly   422 QLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTW-AEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 485
            .|:..|...:.|:.|..:..|......||.|:. |.:..|..|||...:..||.|:..||:....
  Fly    79 GLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDN 143

  Fly   486 EIASGSK----------IRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKD 540
            .:....:          :|   :|::.|:..|::|....:.|.:..:.:...:|:..|..:   .
  Fly   144 RLMPEDRRNYKNVGDAFVR---IVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL---H 202

  Fly   541 GY---NHPLTLLAAGAIAGVPAASLVTPADVIKTRL-QVVARSGQTTYTGVWDATKKIMAEEGPR 601
            ||   ..||.|.|| .::|:..:....|.|:.|||: |:....|:..|:|..|..||::..||..
  Fly   203 GYLSEGIPLHLTAA-LVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAF 266

  Fly   602 AFWKGTAARVFRSSPQFGVTLVTYELLQRL 631
            |.|||....:.|..|.   |:.::..|:::
  Fly   267 AVWKGFTPYLMRMGPH---TIFSFVFLEQM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 29/90 (32%)
PTZ00169 358..631 CDD:240302 80/287 (28%)
Mito_carr 449..539 CDD:278578 21/100 (21%)
Mito_carr 544..633 CDD:278578 28/89 (31%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 30/93 (32%)
PTZ00169 18..296 CDD:240302 80/289 (28%)
Mito_carr 109..205 CDD:278578 20/101 (20%)
Mito_carr 208..300 CDD:278578 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.