DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Tpc2

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:320 Identity:78/320 - (24%)
Similarity:134/320 - (41%) Gaps:51/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 DRSAFIQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQ------RAGSYIGEVAYRNSWDC 402
            :.|..:|::::    ..|..|||...|:..|:|::|.|.|.|      ..||     .||.....
  Fly     3 ENSVVVQLMQA----VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGS-----KYRGVIHA 58

  Fly   403 FKKVVRHEGFMGLYRG-LLPQLMGVAPEKAIKLTVNDLVR----DKLTDKKGNIPTWAE------ 456
            ||.|...||..|::|| ...|::.::         ..||:    ::|.........|.|      
  Fly    59 FKSVYAEEGMRGMFRGHNSGQVLSIS---------YALVQFWSYEQLRSMAHQFDYWRERPFLMF 114

  Fly   457 VLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAWSVVREL----GLFGLYKGARACLLR 517
            .:.||.||....|...|.::|:.::..|...:..|::..::.:|::    |..||.:|....|::
  Fly   115 FICGGIAGCLGAVAAQPFDVVRTQMVAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQ 179

  Fly   518 DVPFSAIYFPTYAHTKA--MMA---DKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVA 577
            ..|.....|..|.:..|  :||   |:....|...|...||::||.|..:|.|||::|.|:|::|
  Fly   180 VFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMA 244

  Fly   578 RSGQTTYTG-------VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQR 630
            ...:....|       :.........|||...|:||....:.::.....|....|::.:|
  Fly   245 FKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 28/108 (26%)
PTZ00169 358..631 CDD:240302 76/306 (25%)
Mito_carr 449..539 CDD:278578 23/104 (22%)
Mito_carr 544..633 CDD:278578 25/94 (27%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 71/294 (24%)
Mito_carr 23..99 CDD:278578 23/89 (26%)
Mito_carr 108..194 CDD:278578 19/85 (22%)
Mito_carr 216..307 CDD:278578 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.