DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Shawn

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:347 Identity:83/347 - (23%)
Similarity:135/347 - (38%) Gaps:110/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 VGATVVYPIDLVKTRMQNQR----------------------------------AGSYIGEVAYR 397
            |.|..:.|:|::|||:|.|:                                  |..:.|.:   
  Fly    52 VTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTI--- 113

  Fly   398 NSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTD------KKGN------ 450
               |.|.|:.|.||...|:.||.|.|:...|...|.....:..:.:.||      ::.:      
  Fly   114 ---DAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDI 175

  Fly   451 ---IPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ--------VAGEIASGSKIRAWSVVRELGL 504
               ||....:|||.......|...:|:|:::.::|        :.|.|.        .||:..|:
  Fly   176 PHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEMFGTIR--------QVVQSQGV 232

  Fly   505 FGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPL--TLLAAGAIAGVPAASLVTPAD 567
            .||::|....:|||||||.||:..|.:.|:..    |...|.  ...|||||:|..||::.||.|
  Fly   233 LGLWRGLPPTILRDVPFSGIYWTCYEYLKSSF----GVVEPTFSFSFAAGAISGSVAATITTPFD 293

  Fly   568 VIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPR---------------------AFWKGTAARV 611
            |:||..|:  ..|:          |.|.::..|:                     |.:.|...|:
  Fly   294 VVKTHEQI--EFGE----------KFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRL 346

  Fly   612 FRSSPQFGVTLVTYELLQRLFY 633
            |:.:|...:.:.::|..:..||
  Fly   347 FKVAPACAIMISSFEYGKSFFY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 26/120 (22%)
PTZ00169 358..631 CDD:240302 81/343 (24%)
Mito_carr 449..539 CDD:278578 28/106 (26%)
Mito_carr 544..633 CDD:278578 26/111 (23%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 24/112 (21%)
Mito_carr 178..265 CDD:278578 28/98 (29%)
Mito_carr 268..371 CDD:278578 28/113 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.