DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Mpcp1

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:348 Identity:81/348 - (23%)
Similarity:139/348 - (39%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PPSSRIDYSDLSNIAPEHYTKHMTHRLAEIKAVESPADRSAFIQVLESSYRFTLGSFAGAVGA-- 369
            |.|:.:....|.::||...|::  |.:|.....|  .|...|    .|::.|.|....|.:..  
  Fly    32 PTSTAVVTPTLKDVAPRQLTRN--HNIAAAAVAE--GDSCEF----GSNHYFLLCGLGGIISCGS 88

  Fly   370 --TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 432
              |:|.|:||||.|:|       :....|::.:..|:..:..||..||.:|..|..:|.:.:...
  Fly    89 THTMVVPLDLVKCRLQ-------VDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLC 146

  Fly   433 KLTVNDLVR----DKLTDKKGNIPTWAEVLAGGCAGASQVVFTN----PLEIVKIRLQVAGEIAS 489
            |..:.::.:    |.:.::...:......||   |.||...|.:    |:|..|:::|.....|.
  Fly   147 KFGLYEVFKKVYGDAIGEENAFLYRTGLYLA---ASASAEFFADIALAPMEAAKVKIQTTPGFAK 208

  Fly   490 GSKIRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM---------ADKDGYNHP 545
            ..:.....:..:.|:...|||.....:|.:|::.:.|..:..|..::         ||.......
  Fly   209 TLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQL 273

  Fly   546 LTLLAAGAIAGVPAASLVTPADVIKTRL-QVVARSG-----QTTYTGVWDATKKIMAEEGPRAFW 604
            :...|||.||||..|.:..|||.:.::| |....|.     |..::|:|....       ||...
  Fly   274 VVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLV-------PRIVM 331

  Fly   605 KGT----------AARVFRSSPQ 617
            .||          |.:||...|:
  Fly   332 IGTLTAAQWFIYDAVKVFLRMPR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 24/105 (23%)
PTZ00169 358..631 CDD:240302 69/297 (23%)
Mito_carr 449..539 CDD:278578 20/102 (20%)
Mito_carr 544..633 CDD:278578 25/90 (28%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 23/95 (24%)
Mito_carr <188..258 CDD:278578 13/69 (19%)
Mito_carr 273..350 CDD:278578 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.