DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and CG18324

DIOPT Version :10

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:294 Identity:90/294 - (30%)
Similarity:138/294 - (46%) Gaps:23/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATV-VYPIDLVKTRMQNQ----RAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYR 417
            |.||..| |:||.| ..|||:||||||.|    ..|:|:  ..||:......::|.::|.:.|.:
  Fly     6 FVLGGTA-AMGAVVFTNPIDVVKTRMQLQGELAARGTYV--KPYRHLPQAMLQIVLNDGLLALEK 67

  Fly   418 GLLPQLMGVAPEKAIKLTV--NDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIR 480
            ||.|.|.......:::|:|  |.|....|.:..|:|..:..:..|...|.:...|.:|..::|.:
  Fly    68 GLAPALCYQFVLNSVRLSVY
SNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ 132

  Fly   481 --LQVAGEIASGSKIRAWS-------VVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM 536
              .|....||.|.:.:..|       :.|..|:.|.::.|...|.|.:..|::...|:...|:::
  Fly   133 QHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLL 197

  Fly   537 ADKDGYNHPLTL-LAAGAIAGVPAASLVTPADVIKTRL--QVVARSGQ-TTYTGVWDATKKIMAE 597
            .||....||:.| ..||..:|...|...:|.||:.||:  |.|...|: ..|.|:.|...||...
  Fly   198 KDKG
WITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262

  Fly   598 EGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRL 631
            ||....:||.....|||:|...:|.|.:|.|..|
  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 FRQ1 32..178 CDD:444056
Mito_carr 350..448 CDD:395101 34/96 (35%)
Mito_carr 449..539 CDD:395101 21/98 (21%)
Mito_carr 544..633 CDD:395101 33/92 (36%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:395101 30/83 (36%)
Mito_carr 101..201 CDD:395101 22/99 (22%)
Mito_carr 204..296 CDD:395101 32/91 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.