DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Dic3

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:122/292 - (41%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 RFTLGSFAGAVGATVVYPIDLVKTRMQNQRAG--SYIGEVAYRNSWDCFKKVVRHEGFMGLYRGL 419
            |:..|....|:..|..:||||:|.::|.|...  ..:||:        .|.:....|.:|.|.|:
  Fly    11 RWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGI 67

  Fly   420 ----LPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIR 480
                ..||.......|:.....|.|..:....|..:.|:|.:: ||..|.       |.::|.:|
  Fly    68 SASWFRQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIV-GGIVGV-------PGDVVTVR 124

  Fly   481 LQVAGEIASGSKIR---------AWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM 536
            ||  .::....:.|         .:.:.:|.|:..|::|....:.|.|..:......|...|.|:
  Fly   125 LQ--NDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML 187

  Fly   537 ADKDGYNHPLTL-LAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGP 600
            ....|....:.| .|...|||..|..:..|.|||||.. :.|:.|:  ::|:..|... .|::||
  Fly   188 KIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTF-MNAQPGE--FSGIGGAFLS-TAKQGP 248

  Fly   601 RAFWKGTAARVFRSSPQFGVTLVTYELLQRLF 632
            .||:||....:.|.||...:|.|.||..:..|
  Fly   249 LAFYKGFIPALIRVSPNTIITFVLYEQARMRF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 23/96 (24%)
PTZ00169 358..631 CDD:240302 74/288 (26%)
Mito_carr 449..539 CDD:278578 20/98 (20%)
Mito_carr 544..633 CDD:278578 31/90 (34%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 73/281 (26%)
Mito_carr 15..91 CDD:278578 20/83 (24%)
Mito_carr 93..187 CDD:278578 20/103 (19%)
Mito_carr 200..281 CDD:278578 30/85 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.