DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and CG4995

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:330 Identity:91/330 - (27%)
Similarity:148/330 - (44%) Gaps:37/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQ 422
            |..|...||.|..|.:|.|.||..:|.....:    ..|:.::.||:.:|:.:.|:|||||:...
  Fly    44 FVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRN----PKYKGTFHCFRTIVQRDKFIGLYRGISSP 104

  Fly   423 LMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEI 487
            :.|:....||...|...|: :|::...::.  :...||..||.:|.....|:|:.|.|||::.::
  Fly   105 MGGIGLVNAIVFGVYGNVQ-RLSNDPNSLT--SHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQV 166

  Fly   488 ASGSKIRA-----WSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLT 547
            .||.|...     ..:|:..|:.|.:||..|.:|||:|..|.||.::.:   :|...:......|
  Fly   167 DSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEY---LMRQVETPGVAYT 228

  Fly   548 LLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVF 612
            |:|.|. ||:.:.....|.||:||.:|..|......|.|..|...|....|||:.|::|..:.:.
  Fly   229 LMAGGC-AGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLI 292

  Fly   613 RSSPQ----FGVTLVTYELL-------------QRLFYVDFGGTQPKGSEAHKITTP-LEQAAAS 659
            |:.|.    |.|.....::.             |.|..|:.........||   |.| :|:....
  Fly   293 RAFPMNAACFFVVSWVLDICNAKGGMDSVMHSDQPLTLVNLDNKSQADLEA---TAPTVEEVVRK 354

  Fly   660 VTTEN 664
            :.|:|
  Fly   355 IITDN 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 27/89 (30%)
PTZ00169 358..631 CDD:240302 82/294 (28%)
Mito_carr 449..539 CDD:278578 28/94 (30%)
Mito_carr 544..633 CDD:278578 28/105 (27%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 26/85 (31%)
PTZ00169 41..295 CDD:240302 78/261 (30%)
Mito_carr 128..218 CDD:278578 27/94 (29%)
Mito_carr 221..304 CDD:278578 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.