DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and CG9582

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:128/282 - (45%) Gaps:14/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 YRFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLL 420
            ::|..|..:|.:.....:|:|:||||||.|.|..:.|||.|....|...|:.|:||...|::|::
  Fly    15 WQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIV 79

  Fly   421 PQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 485
            |.:....|::..|..:.:.::................::|..|...:....||.|:|||..|.  
  Fly    80 PPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQA-- 142

  Fly   486 EIASGSKIRAWSVVREL------GLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDG--Y 542
              ..|.:::..|||:.:      |:.|||:|..|.:.|:..|...:|..|...|.::...:.  |
  Fly   143 --HRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTY 205

  Fly   543 NHPLTLLAAGAIAGVPAASLVTPADVIKTRLQ-VVARSGQTTYTGVWDATKKIMAEEGPRAFWKG 606
            |....::.||..:.:.....|| .|:.|.|:| .....|:..|.......|....|||.|:.:||
  Fly   206 NILRKVIIAGLASSLACVMSVT-LDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKG 269

  Fly   607 TAARVFRSSPQFGVTLVTYELL 628
            ..|.:.|..|...:.|||||.|
  Fly   270 LGAMILRVGPGGAMLLVTYEYL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 27/91 (30%)
PTZ00169 358..631 CDD:240302 79/280 (28%)
Mito_carr 449..539 CDD:278578 24/95 (25%)
Mito_carr 544..633 CDD:278578 26/86 (30%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 79/280 (28%)
Mito_carr 17..104 CDD:278578 27/86 (31%)
Mito_carr 109..196 CDD:278578 24/90 (27%)
Mito_carr 216..295 CDD:278578 24/77 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.