DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and MME1

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:301 Identity:88/301 - (29%)
Similarity:137/301 - (45%) Gaps:49/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQ 422
            |..|...|.....|.:|:|.:|.|:|............|:...||..:..|:|||.|.|||:...
  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82

  Fly   423 LMGVAPEKAIKLTV----------NDLVRDKLTDKKGNIPTWAEVLAGGC-AGASQVVFTNPLEI 476
            |:||.|..|:...|          :|.:|          .|:.::.|.|. ||....:.|.|.:.
  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQTDDHIR----------LTYPQIFAAGALAGVCSALVTVPTDR 137

  Fly   477 VKIRLQVA----------GEIASGSKIRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAH 531
            :|:.||..          |.|.:.:|:     .|:.|:..|:||..||:|||.| :..||.||..
  Fly   138 IKVLLQTQTVSNGPLLYNGTIDTAAKL-----YRQGGIRSLFKGTCACILRDSP-TGFYFVTYEF 196

  Fly   532 TKAMMADK--DGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYT-GVWDATKK 593
            .:.:...|  :|.....:.:.:|..||:...:|..|.||:|:|||   .:.:.||. |:....:.
  Fly   197 LQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQ---SAPEGTYKHGIRSVFRN 258

  Fly   594 IMAEEGPRAFWKGTAARVFRSSPQ-----FGVTLVTYELLQ 629
            :||.|||:|.::|....:.|:.|.     |||.| |.:||:
  Fly   259 LMATEGPKALFRGILPILLRAFPSTAAVFFGVEL-TNDLLK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 28/99 (28%)
PTZ00169 358..631 CDD:240302 88/301 (29%)
Mito_carr 449..539 CDD:278578 28/100 (28%)
Mito_carr 544..633 CDD:278578 30/92 (33%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 26/88 (30%)
Mito_carr 111..205 CDD:278578 29/109 (27%)
Mito_carr 208..297 CDD:278578 29/92 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.