DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:290 Identity:85/290 - (29%)
Similarity:137/290 - (47%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 YRFTLGSFAGA-VGATVVYPIDLVKTRMQNQRAGSYIGEVAYR--NSWDCFK----KVVRHEGFM 413
            ::..:.:|.|| :..:.|:|:|:.|||||..      ||.|.:  .:...|:    .::|.|||.
  Fly    37 FQLYVNTFIGANLAESCVFPLDVAKTRMQVD------GEQAKKTGKAMPTFRATLTNMIRVEGFK 95

  Fly   414 GLYRGLLPQLMGVAPEKAIKLTVNDLVRDK-LTDKKGNIPTWAEVLAGGC---AGASQVVFTNPL 474
            .||.|....:.......::::.:.|:.|.. |...:.|.......:|.||   ||.......||.
  Fly    96 SLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPF 160

  Fly   475 EIVKIRLQVAG-------EIASGSKIRAW-SVVRELGLFGLYKGA-----RACLLR--DVPFSAI 524
            :|||:|:|..|       ::...|.::|: .:.|..||..::||.     ||||:.  ||....|
  Fly   161 DIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDI 225

  Fly   525 YFPTYAHTKAMMADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRL--QVVARSGQTT-YTG 586
            ...|:   |.::..::|.  ||..::: ..||:.|:.|.|||||||:|:  |.|..||:.. |..
  Fly   226 SKRTF---KRLLDLEEGL--PLRFVSS-MCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKN 284

  Fly   587 VWDATKKIMAEEGPRAFWKGTAARVFRSSP 616
            ..|..:|::.|||....:||.....||..|
  Fly   285 SLDCVRKLVREEGVLTLYKGLMPTWFRLGP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 25/99 (25%)
PTZ00169 358..631 CDD:240302 85/288 (30%)
Mito_carr 449..539 CDD:278578 30/107 (28%)
Mito_carr 544..633 CDD:278578 29/76 (38%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 20/80 (25%)
Mito_carr 137..232 CDD:278578 28/97 (29%)
Mito_carr 237..329 CDD:278578 30/81 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.