DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and colt

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:289 Identity:82/289 - (28%)
Similarity:138/289 - (47%) Gaps:18/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQ 422
            |..|.|.|.......:|:|.:|.|:|.....:...:..||.::||..|.:::||..|||:|:...
  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83

  Fly   423 LMGVAPEKAI---KLTVNDLVRDKLTDKKGNIPTWAEV-LAGGCAGASQVVFTNPLEIVKIRLQV 483
            |.||||..|:   ...:...::.:..|.|   .|:.:: :||..:|....:...|.|.:|:.||.
  Fly    84 LTGVAPIFAMCFAGYALGKRLQQRGEDAK---LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQT 145

  Fly   484 ----AGEIASGSKIR-AWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKD--G 541
                .||......|. |..:.:|.||..::||:.|.:|||:|.:.:||..|...:.:...|.  |
  Fly   146 QQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETG 210

  Fly   542 YNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYT-GVWDATKKIMAEEGPRAFWK 605
            .....:.:.||.:||:....|..||||:|:|||   .:.:.||. |:....|.::.::||.|.::
  Fly   211 QISTASTIFAGGVAGMAYWILGMPADVLKSRLQ---SAPEGTYKHGIRSVFKDLIVKDGPLALYR 272

  Fly   606 GTAARVFRSSPQFGVTLVTYELLQRLFYV 634
            |....:.|:.|.........||..:.|.:
  Fly   273 GVTPIMLRAFPANAACFFGIELANKFFNI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 27/92 (29%)
PTZ00169 358..631 CDD:240302 81/284 (29%)
Mito_carr 449..539 CDD:278578 26/95 (27%)
Mito_carr 544..633 CDD:278578 25/89 (28%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/87 (30%)
Mito_carr 112..202 CDD:395101 27/92 (29%)
Mito_carr 210..299 CDD:395101 26/91 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.