DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Ant2

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:293 Identity:69/293 - (23%)
Similarity:125/293 - (42%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYI-GEVAYRNSWDCFKKVVRHEGFMGLYRGLLP 421
            |.:|..:.|:..|.|.||:.||..:|.|.....| .:..|:...|||.::.:.:||...:||.|.
  Fly    22 FMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLA 86

  Fly   422 QLMGVAPEKAIKLTVNDLVRDKL---TDKKGNIPTW----AEVLAGGCAGASQVVFTNPLEIVKI 479
            .::...|.:|:.....|:.:...   .||....  |    ..:.:||.|||:.:.|..||:..:.
  Fly    87 NVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQF--WRHFAGNLASGGAAGATSLCFVYPLDFART 149

  Fly   480 RLQVAGEIASGSKIRAWS--------VVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM 536
            ||  |.::..|.. |.::        |::..|..|||:|....:...|.:.|.||..|...:..:
  Fly   150 RL--AADVGKGGN-REFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFL 211

  Fly   537 ADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVA--RSGQTTYTGVWDATKKIMAEEG 599
            .:.......::...|..:..| |.....|.|.::.|:.:.:  :..:..|.........|..:||
  Fly   212 PNPKSTPFYVSWAIAQVVTTV-AGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEG 275

  Fly   600 PRAFWKGTAARVFRSSPQFGVTLVTYELLQRLF 632
            ..||:||..:.:.|.:.. .:.|..|:.:::.|
  Fly   276 IGAFFKGALSNIIRGTGG-ALVLALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 25/93 (27%)
PTZ00169 358..631 CDD:240302 68/290 (23%)
Mito_carr 449..539 CDD:278578 25/101 (25%)
Mito_carr 544..633 CDD:278578 18/91 (20%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 68/289 (24%)
Mito_carr 17..111 CDD:278578 24/88 (27%)
Mito_carr 119..215 CDD:278578 25/100 (25%)
Mito_carr 218..307 CDD:278578 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.