DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and sesB

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:293 Identity:74/293 - (25%)
Similarity:130/293 - (44%) Gaps:27/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIG-EVAYRNSWDCFKKVVRHEGFMGLYRGLLP 421
            |..|..:.||..|.|.||:.||..:|.|.....|. :..|:...|||.::.:.:||...:||.|.
  Fly    27 FAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLA 91

  Fly   422 QLMGVAPEKAIKLTVNDLVRDKL---TDKKGNIPTW----AEVLAGGCAGASQVVFTNPLEIVKI 479
            .::...|.:|:.....|..:...   .||  |...|    ..:.:||.|||:.:.|..||:..:.
  Fly    92 NVIRYFPTQALNFAFKDKYKQVFLGGVDK--NTQFWRYFAGNLASGGAAGATSLCFVYPLDFART 154

  Fly   480 RLQVAGEIASGSKIRAWS--------VVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM 536
            ||  |.:...|.: |.::        :.:..|:.|||:|....:...:.:.|.||..|...:.|:
  Fly   155 RL--AADTGKGGQ-REFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGML 216

  Fly   537 ADKDGYNHPLTLLAAGAIAGVPAASLVT-PADVIKTRLQVVA--RSGQTTYTGVWDATKKIMAEE 598
            .|..  |.|:.:..|.|......|.:|: |.|.::.|:.:.:  ::.:..|.........|..:|
  Fly   217 PDPK--NTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQE 279

  Fly   599 GPRAFWKGTAARVFRSSPQFGVTLVTYELLQRL 631
            |..||:||..:.:.|.:.. ...||.|:.::::
  Fly   280 GTGAFFKGAFSNILRGTGG-AFVLVLYDEIKKV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 26/93 (28%)
PTZ00169 358..631 CDD:240302 74/291 (25%)
Mito_carr 449..539 CDD:278578 25/101 (25%)
Mito_carr 544..633 CDD:278578 20/91 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 25/88 (28%)
PTZ00169 23..312 CDD:240302 74/293 (25%)
Mito_carr 124..220 CDD:278578 25/98 (26%)
Mito_carr 223..312 CDD:278578 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.