DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and CG1628

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:319 Identity:87/319 - (27%)
Similarity:129/319 - (40%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 IQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFM 413
            |..:|....|..||..||....|..|:|.||.::|.       ...|||...|||....|.:|.:
  Fly   164 INFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQT-------FPEAYRGMLDCFLSTYRKDGVL 221

  Fly   414 -GLYRGLLPQLMGVAPEKAI-----------------KLTVNDLVRDKLTDKKGNIPTWAEVLAG 460
             |||.|.:|.:.....|.::                 |.|..||.                .:..
  Fly   222 RGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLT----------------TVQN 270

  Fly   461 GCAGASQVVFTN----PLEIVKIRLQVAGEI------ASGSKIRA-WSVVREL----GLFGLYKG 510
            .|||:....|:.    |.|::|.:||...|:      |....||. |::.|.:    |:.|.|:|
  Fly   271 ACAGSLAACFSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRG 335

  Fly   511 ARACLLRDVPFSAIYFPTYAHTKAMM----ADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKT 571
            ..:..||::|....:|.:|..|:.::    ..||... ||..:.||||.||...:...||||||:
  Fly   336 LSSTFLREMPGYFFFFGSYEGTRELLRRDDQSKDDIG-PLRTMIAGAIGGVCLWTSTFPADVIKS 399

  Fly   572 RLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQR 630
            |:||     :.....::.....|:..||..|.::|....|.|:.|......|.||..:|
  Fly   400 RIQV-----KNLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 30/115 (26%)
PTZ00169 358..631 CDD:240302 85/310 (27%)
Mito_carr 449..539 CDD:278578 25/108 (23%)
Mito_carr 544..633 CDD:278578 29/87 (33%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 87/319 (27%)
Mito_carr 170..252 CDD:278578 25/88 (28%)
Mito_carr 263..364 CDD:278578 27/116 (23%)
Mito_carr 369..455 CDD:278578 30/91 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.