DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and cal-4

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001379504.1 Gene:cal-4 / 177945 WormBaseID:WBGene00000288 Length:236 Species:Caenorhabditis elegans


Alignment Length:211 Identity:45/211 - (21%)
Similarity:83/211 - (39%) Gaps:60/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ANIAD-----------TSKDGLISFSEFQAFEGLLCTPDAL--YRTAFQLFDRKGNGTVSYADFA 131
            ||.||           |::.......||        ||:.|  :..||:|||:.||.|::..:..
 Worm    44 ANAADCLARRDMYRQGTNQSVCSDADEF--------TPEELQEFAQAFKLFDKDGNNTMNIKELG 100

  Fly   132 DVVQKTELHSKIPFSLDGPFIKRYFGDKKQRLINYAEFTQLLHDFHEEHAME----AFRSKDPAG 192
            :.::...|:......|:  .:..|..|...: |::.||.:::.:.::|...|    ||:..|..|
 Worm   101 EAMRMLGLNPTEEELLN--MVNEYDVDGNGK-IDFGEFCKMMKEMNKETDQELIRLAFKVFDKDG 162

  Fly   193 TGFISPLDFQDIIVNVKRHLLTPGVRDNLVSVTEGHKVSFPYFIAFTSLLNNM-----------E 246
            .|:|:..:|       |..:.|.|.|.:...|.|              ::..:           |
 Worm   163 NGYITAQEF-------KHFMTTMGERFSEEEVDE--------------IIREVDKDGDEQIDLDE 206

  Fly   247 LIKQVYLHATEGSRTD 262
            .:..|....::|::||
 Worm   207 FVNMVAPIVSDGTKTD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234 7/29 (24%)
EF-hand_8 51..99 CDD:290545 7/29 (24%)
EF-hand_7 81..134 CDD:290234 17/65 (26%)
EFh 84..135 CDD:298682 15/63 (24%)
EF-hand_7 111..173 CDD:290234 15/61 (25%)
Mito_carr 350..448 CDD:278578
PTZ00169 358..631 CDD:240302
Mito_carr 449..539 CDD:278578
Mito_carr 544..633 CDD:278578
cal-4NP_001379504.1 PTZ00184 68..211 CDD:185504 36/174 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.