DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi17

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster


Alignment Length:266 Identity:52/266 - (19%)
Similarity:105/266 - (39%) Gaps:62/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVDRYAAGEDLADKSWISQMKKLRSDLRDCYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDG 80
            |..|:|:|.:|.|           ..:||||   :...: |||:.......:.::...::::.. 
  Fly   145 LARRFASGNELWD-----------GLVRDCY---LKPDV-SCFQKNVFSYLDNVLDVQDVNVTQ- 193

  Fly    81 VRLVAAPNSTD-NATRPDDERKDLKHL---TWFDQLAVSL----AKGLTTHTLQVNLG------- 130
             ||....|..| ...:..:|..:.:..   |..:::..:|    .|...||.|:|:|.       
  Fly   194 -RLKFFKNQVDYQVDKEKEEHSEARAASAETPIEEVTSALYGKSIKFAMTHDLEVDLPEVMFNGA 257

  Fly   131 --KLTERYLSSD------TSNPDPVGSARV----------RRHRYNMIITMMFGVTALGAILVPM 177
              :::.|.:..:      ...|..|..||:          :..|..::::.:..:..:..|.:.:
  Fly   258 TFRISPRAIEGNGIIAKLELIPKQVVKARLAGAIIQKKIQKFLRSKLVLSFLALLLIIKIIKIKL 322

  Fly   178 GFQMLSIVSG----KALLLAKMALLLASINGLKRVANNGLHY-GLYHVPGEHLGGYYDRGDVSHP 237
             |.:|.||.|    |.|||..:..|..:::.|.::.:   || ..||.|.::   ::....:.|.
  Fly   323 -FWLLPIVIGVGAAKKLLLKFLLFLFPALSHLFKLCS---HYQQSYHAPAKY---HHHHHLIDHH 380

  Fly   238 RNVPIP 243
            ..|..|
  Fly   381 HTVVPP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 19/129 (15%)
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 14/91 (15%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.