DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi15

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:171 Identity:31/171 - (18%)
Similarity:70/171 - (40%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SSPEISIYDGVRLVAAPN----STDNATRPDDERKDLKHLTWFDQLAVSLAKGLTTHTLQVNLGK 131
            |...::::.|:|:..:.:    ....|....::|.:               :.|.||.|.::...
  Fly    40 SEESVALFGGLRIDRSESGRSFGASKAVESFEDRAE---------------RYLETHELNLSFSG 89

  Fly   132 LTERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMA 196
            ..:...|.:......:..:|.:|.: .|::.::..:....|::|.:.|.::..:|.|||.::.:|
  Fly    90 DEQDENSENEYTGRAMDESRSKRMK-KMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLA 153

  Fly   197 LLLASINGLK-RVANNGLHYGLYHVPGEHLGGYYDRGDVSH 236
            |:||.....| .:|....|....::.|..|     ..|:.|
  Fly   154 LILAGATFFKDLLAKKKEHITTAYITGSPL-----NADIVH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 13/95 (14%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 24/138 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.