DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi13

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:203 Identity:39/203 - (19%)
Similarity:76/203 - (37%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LHI-----FEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTWFDQLAVSLAKGLTT 122
            ||:     |.|..:.|.:....|..:.|.....:.....::.::..:|  |.......|...:|.
  Fly    11 LHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAEERQRVERH--WLSMAETQLHSLITD 73

  Fly   123 HTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVPMGFQMLSIVSG 187
            ......:..:.|      |.:.:..|..:.::....|:..::..|.....:|:|:..:.|:.:|.
  Fly    74 DLSTEEVNNMLE------TWSTEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALST 132

  Fly   188 KALLLAKMALLLASINGLKRVANNG--------LHYGLYHVPGEHLGGYYDRGDVSHPRNVP-IP 243
            .:.::.|:||:.:.|..||.:.:.|        :|.....|.|.|.......|....|...| ||
  Fly   133 SSFVMGKIALVTSGILALKWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSSGSSWMPIRQPFIP 197

  Fly   244 -VAVAPTL 250
             |:..|.|
  Fly   198 LVSKDPNL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 13/96 (14%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.