DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi12

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster


Alignment Length:181 Identity:47/181 - (25%)
Similarity:86/181 - (47%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CFRSRSLHIFEGIMSSPEISIYDGVRLV---AAP-------NSTDNATRPDDERKDLKHLTWFDQ 111
            |.:.:::...:.:.....|::.:|::||   .||       |..:::.......:|.| ||  :.
  Fly    65 CLKKKAISFIDRLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDAK-LT--NM 126

  Fly   112 LAVSLAKGLTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVP 176
            |...|:.....|:|||:..|||    |.:.......|..::::    |:..||.|:......::|
  Fly   127 LIERLSYFFNGHSLQVSFPKLT----SDEIGRGLEEGRGKMKK----MMGMMMMGMAMKMMGMIP 183

  Fly   177 MGFQMLSIVSGKALLLAKMALLLASINGLKRVANNGLHYGLYHVPGEHLGG 227
            :....|.|::||||:::|:|||||.|.|||::           :.|:..||
  Fly   184 IAMGALYILAGKALIISKIALLLAGIIGLKKL-----------MSGKSSGG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 23/106 (22%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.