DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi11

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster


Alignment Length:263 Identity:65/263 - (24%)
Similarity:107/263 - (40%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LRDCY-QSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDD------- 98
            :|..| |....:.::.|.:.:.:.:....:..|::.|.|||.||...:.|.: ||...       
  Fly    40 VRHIYGQCAYSEDVFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQD-TRSGRSSLLESQ 103

  Fly    99 -ERKDLKHLTWFDQLAVSLAKGLT---THTLQVNLGKLTERYLSSDTSN----------PDPVGS 149
             ..:||:||:.....|:.|.:.|.   :|.|||||.:|. |:...:..:          |.....
  Fly   104 LSNRDLEHLSGKSLDALLLERFLNFVHSHQLQVNLPRLL-RFGERNVQDWLLHVVGYFMPASESE 167

  Fly   150 ARVRRHRYNMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKR-VANNG- 212
            .|.::.....:...:..|....||| .|.:..::||:||||::.|:||::::|.|||: |.::| 
  Fly   168 GRKKKDDKKYLGPFIAAVLLKTAIL-KMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGG 231

  Fly   213 ---------------------LHYGLYHVPGEHLGGYYDRGD--------------VSHPRNVPI 242
                                 .|.|.|.. |.|.||.|.|..              :.|....|.
  Fly   232 EKTTYEIVKHPQVQQSHTYSSSHQGEYDT-GGHDGGSYHRSIDDEMMMQDKAYQAWMPHVAASPS 295

  Fly   243 PVA 245
            |||
  Fly   296 PVA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 27/117 (23%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.