DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi10b

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:219 Identity:51/219 - (23%)
Similarity:84/219 - (38%) Gaps:77/219 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTW--FDQLAVSLA 117
            |.|..|.|..:.:|                        |||.:.        ||  .|.|::...
  Fly    54 WQCLGSESEQLLDG------------------------ATRDNS--------TWQITDYLSIEPK 86

  Fly   118 KGLT---THTLQVNL-GKLTE------------RYLSSDTSNP-DPVGS------ARVRRHR-YN 158
            .|::   |..:.:.| |||.|            |.|:  .||. |..||      .|.::.: .|
  Fly    87 VGISKPETRRMDMGLPGKLLELVQGRALRLQLPRQLT--ISNAIDDFGSELGLDQGRKKKDKDKN 149

  Fly   159 MIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKR----VANNGLHYGLYH 219
            |  .||.|:..: |.|..|....:.:::|.|.::||:||:::.:..||:    .:.:|...|..|
  Fly   150 M--AMMGGMIMM-ATLAQMFLGKVILIAGSAFIMAKIALVISLLGSLKKGSTGHSGSGGGSGTEH 211

  Fly   220 --VPGEHLGGYYDRGDVSHPRNVP 241
              |...|..|::        |::|
  Fly   212 VVVHSSHESGWH--------RSMP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 25/122 (20%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 42/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.