DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi8

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:180 Identity:44/180 - (24%)
Similarity:85/180 - (47%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YQ--SGIHQSLWSCFRSRSLHIFE-GIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDL---- 103
            ||  ||.:.|:  |.:.:.|...| ...|:..:|:.:|::.|::...::...|.....||:    
  Fly    65 YQQCSGDNMSV--CLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAPISEKDIEAVL 127

  Fly   104 ------KHLTWFDQLAVSLAKGLTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIIT 162
                  |.....:.:...:...|..|||||..           .:..:.|...:.:..:.|..:.
  Fly   128 PRSVDAKEQVLNNMILKRVGNFLQDHTLQVKF-----------DNEANSVEGRKKKEKKGNGAMI 181

  Fly   163 MMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANNG 212
            |:  ...||..:||:.:..|::::||||:::|:||:||||.|:|::.:.|
  Fly   182 MI--PLLLGGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 17/107 (16%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 16/94 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.