DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi6

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:255 Identity:56/255 - (21%)
Similarity:101/255 - (39%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSVLVTFLLGVILVDRYAAGEDLADKSWISQMKKLRSDLRDCYQSGIHQSLWSCFRSRSLHIFEG 68
            |:..:.|.:....:...|||.. ||.  :...::.......|.:|   .|: ||.:.......:.
  Fly    23 PATSMKFFVATACILLLAAGIS-ADP--VKAAEEQPGAFAQCLES---DSI-SCLQLTLFRKAKS 80

  Fly    69 IMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTWFDQLAVSLAKGLTTHTLQVNLGK-- 131
            :..:|:|.::.||.||.:           :|.:..|.|.  :.|||..|..:...|.:  :|.  
  Fly    81 VFDNPQIELFGGVSLVKS-----------NEGRQGKSLD--NSLAVEAAPTVEARTAE--MGNYF 130

  Fly   132 -------LTERYLSSDTSN---------PDPVGS--------ARVRRHR-YNMIITMMFGVTALG 171
                   ..||.|:.:.:|         ||.:.:        :|.|:.: ....:.::.||.|..
  Fly   131 MDNAKSFFAERSLNFNFANAARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKI 195

  Fly   172 AILVPMGFQMLSIVSGKALLLAKMALLLA----SINGLKRVANNGLHYGLYHVPGEHLGG 227
            |:|.......|..::.|||:::.:|..||    :.:||.|:..:|...||....|...||
  Fly   196 AVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGGLGGLFGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 23/123 (19%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.