DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi23 and Osi3

DIOPT Version :9

Sequence 1:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:223 Identity:54/223 - (24%)
Similarity:86/223 - (38%) Gaps:79/223 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVDRYAAGED-----LADKSWISQM--KKLRSDLRDCYQSGIHQSLWSCFRSRSLH--IFEG--- 68
            |.||:...|:     :.|...::|:  :.:.|| .:.:...:...||...|||||.  ..|.   
  Fly    79 LGDRFKVTENGNISMVPDDPEVNQLLSRSMGSD-EETFALLMANKLWKFIRSRSLRYKFSENTDF 142

  Fly    69 -IMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTWFDQLAVSLAKGLTTHTLQVNLGKL 132
             |.|.||.|:..||           :.||                         ...||...||:
  Fly   143 VINSDPEGSLNLGV-----------SVRP-------------------------LEALQEGRGKM 171

  Fly   133 TERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTAL-GAILVPMGFQMLSIVSGKALLLAKMA 196
                     .|..|             ::.||...|.: ||:|:    :.|.:::||||:::|:|
  Fly   172 ---------KNMGP-------------LLMMMAAKTGMVGALLL----KGLFLLAGKALIVSKIA 210

  Fly   197 LLLASINGLKRVANNGLHYGLYHVPGEH 224
            ||||.|..||::.::  ...:..||..|
  Fly   211 LLLAVIISLKKLLSS--KKTIVEVPSHH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 16/100 (16%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.