DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15537 and Crhbp

DIOPT Version :9

Sequence 1:NP_001097981.1 Gene:CG15537 / 43614 FlyBaseID:FBgn0039770 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_631922.1 Gene:Crhbp / 29625 RGDID:2403 Length:322 Species:Rattus norvegicus


Alignment Length:246 Identity:71/246 - (28%)
Similarity:118/246 - (47%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QPEV-CGLYVIGEPDTIVEITMKHYD---ANCETGALMAFVDGWELNGEYFPGIKDHHRPLEERV 169
            ||:: |..:.||||:..:.|   |:|   .:|:.|..:...|||.|.||.||..:||..|..||.
  Rat    76 QPQLHCAAFFIGEPEEFITI---HFDLVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPTRERY 137

  Fly   170 YEFCNNYRQWPRVSNKKFFRSSQNAALLQYRIPVRGS-FVANVRFHKITQPCNVLVQDTAAMYKM 233
            .:||.:      ...::...||||.|::.:|:...|: |...::......|||::.|..:..:.:
  Rat   138 TDFCES------GLTRRSVTSSQNVAMVFFRVHEPGNGFTITIKTDPNLFPCNIISQTPSGRFTL 196

  Fly   234 TNFGQARNCTISALFPAVVSLASLRIGGKSVRAQPKVNYDCQLPSDRLEIGGAAGLDAIGMEQAS 298
            ....|.:||:.|.::|..:.::.|.:|........|....|....|.:|:.|..|||...|....
  Rat   197 VVPYQHQNCSFSIIYPVTIKISDLALGHLHGLQLKKPAAGCGGTGDFVELLGGTGLDTSKMMLLV 261

  Fly   299 AVCGASSDLGPEQ-AIFCGVSTVRLVSSGRYQNQAAIVLRKADVPDMEIAT 348
            .:|....  ||.| .|.|..:.||:||||::.|:.....|:.:..::|.:|
  Rat   262 DLCYPFH--GPAQMKISCDNAVVRMVSSGKHMNRVTFEYRQLEPLELETST 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15537NP_001097981.1 CRF-BP <109..345 CDD:283162 69/241 (29%)
CrhbpNP_631922.1 CRF-BP 1..307 CDD:283162 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349439
Domainoid 1 1.000 104 1.000 Domainoid score I6604
eggNOG 1 0.900 - - E1_28J9S
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1418
Inparanoid 1 1.050 107 1.000 Inparanoid score I4827
OMA 1 1.010 - - QHG47583
OrthoDB 1 1.010 - - D1361570at2759
OrthoFinder 1 1.000 - - FOG0008255
OrthoInspector 1 1.000 - - oto97292
orthoMCL 1 0.900 - - OOG6_109275
Panther 1 1.100 - - LDO PTHR10278
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6223
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.