DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15537 and Crhbp

DIOPT Version :9

Sequence 1:NP_001097981.1 Gene:CG15537 / 43614 FlyBaseID:FBgn0039770 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_940800.1 Gene:Crhbp / 12919 MGIID:88497 Length:322 Species:Mus musculus


Alignment Length:251 Identity:75/251 - (29%)
Similarity:121/251 - (48%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ADVQELQPEVCGLYVIGEPDTIVEITMKHYD---ANCETGALMAFVDGWELNGEYFPGIKDHHRP 164
            ||..:|.   |..:.||||:..:.|   |||   .:|:.|..:...|||.|.||.||..:||..|
Mouse    74 ADRPQLH---CAAFFIGEPEEFITI---HYDLVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLP 132

  Fly   165 LEERVYEFCNNYRQWPRVSNKKFFRSSQNAALLQYRIPVRGS-FVANVRFHKITQPCNVLVQDTA 228
            ..:|..:||.:      ...::..|||||.|::.:|:...|: |...::......||||:.|..:
Mouse   133 TMKRYTDFCES------GLTRRSIRSSQNVAMVFFRVHEPGNGFTITIKTDPNLFPCNVISQTPS 191

  Fly   229 AMYKMTNFGQARNCTISALFPAVVSLASLRIGGKSVRAQPKVNYDCQLPSDRLEIGGAAGLDAIG 293
            ..:.:....|.:||:.|.::|..:.::.|.:|........|....|....|.:|:.|..|||...
Mouse   192 GRFTLVVPYQHQNCSFSIIYPVAIKISDLTLGHLHGLQLKKPAAGCGGTGDFVELLGGTGLDPSK 256

  Fly   294 MEQASAVCGASSDLGPEQ-AIFCGVSTVRLVSSGRYQNQAAIVLRKADVPDMEIAT 348
            |...:.:|  ...|||.| .|.|..:.||:||||::.|:.....|:.:..::|.:|
Mouse   257 MMPLADLC--YPFLGPAQMKISCDNAVVRMVSSGKHINRVTFEYRQLEPFELETST 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15537NP_001097981.1 CRF-BP <109..345 CDD:283162 70/240 (29%)
CrhbpNP_940800.1 CRF-BP 1..307 CDD:283162 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846002
Domainoid 1 1.000 106 1.000 Domainoid score I6624
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1418
Inparanoid 1 1.050 109 1.000 Inparanoid score I4893
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47583
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008255
OrthoInspector 1 1.000 - - oto93748
orthoMCL 1 0.900 - - OOG6_109275
Panther 1 1.100 - - LDO PTHR10278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5320
SonicParanoid 1 1.000 - - X6223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.