DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and Smpdl3a

DIOPT Version :9

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_065586.3 Gene:Smpdl3a / 57319 MGIID:1931437 Length:445 Species:Mus musculus


Alignment Length:423 Identity:125/423 - (29%)
Similarity:198/423 - (46%) Gaps:63/423 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 HLTDIHYDPEYAEGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPKRLILSAFEHIKEN 281
            |:||:|.||.|    :...|....|.:|  :|:::|....|....  ||.|.:||||||:.||.:
Mouse    39 HVTDLHLDPTY----HITDDRTKVCASS--KGANASNPGPFGDVL--CDSPYQLILSAFDFIKNS 95

  Fly   282 -HKIEWIYHTGDVPPHNVWSTTRQGN-LDMLSEIDELLAKYFPDTPIYPCLGNHEPHPANVFGND 344
             .:..::..|||.|||........|. :.:::.:...:...||:..::|.||||:..|     .|
Mouse    96 GQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWP-----QD 155

  Fly   345 EIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYT--ASPSKGHRIVALNSMDCYLYNWWLF 407
            ::|  :....:|..|..||..||..||..|:.:||:|:  .:.:.|.||::||:.        |:
Mouse   156 QLP--IVTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNPGLRIISLNTN--------LY 210

  Fly   408 Y-------NATLIQEQLQWFHDTLLSAEEAGESVHILTHIPAGDGDCWCNWS-------QEYNR- 457
            |       |.|....|.:|..:||.|:....|.|:|:.|:|.|    :..::       |.||. 
Mouse   211 YGPNIMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVG----YLPYATDTPAIRQYYNEK 271

  Fly   458 ---VLTRFNGIITGVFSGHTHKDEMNLHYSEDG-------YATVVNWNGGSLTSYSNKNPNYRLY 512
               :..|::.:|.|.|.||||:|.:.:...::|       .|..|....|.|...:| ||..||:
Mouse   272 LLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTPVKGVLQKETN-NPGVRLF 335

  Fly   513 ELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEYT-EDTSPAGIDRLLLEMAEKPD- 575
            :..|.::.:||...|..|||||||..:.  .|.|||..|:.|: .|..|..:..|:.:.|.|.. 
Mouse   336 QYKPGDYTLLDMVQYYLNLTEANLKGES--NWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSK 398

  Fly   576 LLRKFWRNKFTNSDPKLAEGCDNACLSKTICRI 608
            ...|::...|.:.|....  ||..|.:..:|.|
Mouse   399 QFLKYYHYYFVSYDSSAT--CDQHCKTLQVCAI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 93/321 (29%)
Metallophos 271..477 CDD:278574 67/227 (30%)
Smpdl3aNP_065586.3 MPP_ASMase 37..333 CDD:277321 93/321 (29%)
Metallophos 73..294 CDD:278574 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53732
OrthoDB 1 1.010 - - D1142100at2759
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.