DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and CG43897

DIOPT Version :9

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster


Alignment Length:419 Identity:78/419 - (18%)
Similarity:130/419 - (31%) Gaps:139/419 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 ILSAFEHIKENHKIEWIYHTGDVPPHNVWSTTRQGNLDMLSEIDELLAKYFPDTPIYPCLGNHEP 335
            :|.|.|..::..|      .||.|..:.:.|.||.......|:|.|               :|..
  Fly    58 VLRAVEEEEQQAK------CGDFPHKDFYPTERQSRPRQRGEVDAL---------------HHTL 101

  Fly   336 HPANVFGNDEIPSSLRVDWL---------------------YEHVWSLWSKWLPAEAEETVL--- 376
            |       .::.:.::.|:|                     ..|:......|.|||.::..:   
  Fly   102 H-------QQLLNQIKTDYLSHQQDITIDRDTVLKINRLATKRHLLKRDHSWPPAEQDQPTINPE 159

  Fly   377 RGGYYTASPSKGHRIVALNSMDCYLYNWWLFYNATLIQEQLQWFHDTLLSAEEAGESVHILTHIP 441
            :....:.|||  |.|.||...         |.:.||:.|.         :|.|..|.       .
  Fly   160 QSHQISCSPS--HSIEALREK---------FQSPTLVIEP---------TANEVREQ-------R 197

  Fly   442 AGDGDCWCNWSQEYNRVLTRFNGIITGVFSGHTHKDEMNLHYSEDGYATVVNWNGGSLTSYSNKN 506
            ..||.     |:|.::.|.:           ||.:.::    :|..:.|.:: .|.|.......:
  Fly   198 RRDGG-----SKERSKTLQK-----------HTKEPDL----AEVFHQTPIS-KGFSAPETKAAD 241

  Fly   507 PNYRLYELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEYTEDTSPAGIDRLLLEMA 571
            .:..|.....|.::.|.|...........:|| .:|:::                       ..|
  Fly   242 VDLGLVAPRCEYYEQLAHKRSATPTLPTQITP-YRPRYK-----------------------RQA 282

  Fly   572 EKPDLLRKFWRNKFTNSDPKLAEGCDNACLSKTICRIATSNYQERTRCKELQAILAESLENEPDT 636
            ...|..|.   .|.|...|:|...           :..||..:.:.||.:|...:..|..::.|:
  Fly   283 HSLDRSRS---RKRTVGAPELPPP-----------KPRTSKPKVQRRCIKLATEVKISYGHDGDS 333

  Fly   637 -DDNNGGGAAGLSALSLASLLALLAASKL 664
             ||.|.|....|..|.|.......||:.|
  Fly   334 EDDPNSGQDVDLETLPLPPTPVSPAAANL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 47/262 (18%)
Metallophos 271..477 CDD:278574 43/229 (19%)
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.