DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and Smpdl3b

DIOPT Version :9

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001020908.1 Gene:Smpdl3b / 362619 RGDID:1307458 Length:456 Species:Rattus norvegicus


Alignment Length:432 Identity:125/432 - (28%)
Similarity:199/432 - (46%) Gaps:57/432 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 HLTDIHYDPEYAEGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPKRLILSAFEHIKE- 280
            |::|:|.||.|    ..:.|....|.::   ||.....||.|.||. ||.|..||.|:...:|| 
  Rat    25 HISDLHLDPNY----TVSKDPLRVCPSA---GSQPVLNAGPWGDYL-CDSPWALINSSIYAMKEI 81

  Fly   281 NHKIEWIYHTGDVPPHNVWSTTRQGN-LDMLSEIDELLAKYFPDTPIYPCLGNHEPHPANVFGND 344
            ..|.::|:.|||..||.......:|. |.|:..:..|:.:.||.|.:|..||||:.||.|     
  Rat    82 EPKPDFIFWTGDDTPHVPNERLGEGAVLSMVDRLTNLIKEVFPGTKVYAALGNHDFHPKN----- 141

  Fly   345 EIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYT---ASPSKGHRIVALNSMDCYLYNWWL 406
            ::|:  :.:.:|.||..||..||..|:......|.:|:   .||||..|:|.||:.        |
  Rat   142 QLPA--QSNSIYTHVAELWRPWLSNESFTLFKEGAFYSEKLPSPSKTGRVVVLNTN--------L 196

  Fly   407 FYNATLIQ-------EQLQWFHDTLLSAEEAGESVHILTHIPAG-----DGDCWC--NWSQEYNR 457
            :|::....       :|.||..|.|.:|...||.|:|:.|:|.|     ....|.  ::::||.:
  Rat   197 YYSSNEQTAGMADPGQQFQWLGDVLSNASRNGEMVYIIGHVPPGFFEKTQDKAWFRESFNEEYLK 261

  Fly   458 VLTRFNGIITGVFSGHTHKDEMNLHYSEDGYATVVNWNGGSLTSYSN---------KNPNYRLYE 513
            |:.:.:.:|.|.|.||.|.|...:.||..|....|.:....:|.:..         .||..|::|
  Rat   262 VVQQHHRVIAGQFFGHHHTDSFRMFYSSTGAPISVMFLTPGVTPWKTTLPGVVDGANNPAIRIFE 326

  Fly   514 LHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEY-TEDTSPAGIDRLLLEMAEKPDLL 577
            .......:.|..||..||.:|:  ..|.|:||.||:.|:.| .:|.|.:.:...|..:|.:..:|
  Rat   327 YDRATLNLKDMVTYYLNLRQAD--TQETPQWEQEYRLTEAYEVQDASTSSMYTALTRIASEQHIL 389

  Fly   578 RKFWRNKFTNSDPKLAEGCDNACLSKTICRIATSNYQERTRC 619
            ::::   ..||.....:.|::.|..:.:|.|....:.....|
  Rat   390 QRYY---VYNSVSYSHQPCEDVCRREHVCAIQHVEFDTYATC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 97/320 (30%)
Metallophos 271..477 CDD:278574 70/224 (31%)
Smpdl3bNP_001020908.1 Metallophos 22..281 CDD:278574 89/278 (32%)
MPP_ASMase 23..323 CDD:277321 97/320 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53732
OrthoDB 1 1.010 - - D369165at33208
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.