DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15534 and Smpdl3a

DIOPT Version :9

Sequence 1:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001005539.1 Gene:Smpdl3a / 294422 RGDID:1359277 Length:445 Species:Rattus norvegicus


Alignment Length:424 Identity:124/424 - (29%)
Similarity:199/424 - (46%) Gaps:65/424 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 HLTDIHYDPEYAEGSNAACDEPMCCRNSLPEGSDSSAAAGFWSDYRDCDCPKRLILSAFEHIKEN 281
            |:||:|.||.|    :...|....|.:|  :|::.|....|....  ||.|.:||||||:.||.:
  Rat    39 HVTDLHLDPTY----HITDDHTKVCASS--KGANVSNPGPFGDVL--CDSPYQLILSAFDFIKNS 95

  Fly   282 -HKIEWIYHTGDVPPHNVWSTTRQGN-LDMLSEIDELLAKYFPDTPIYPCLGNHEPHPANVFGND 344
             .:..::..|||.|||........|: :::::.:...:...||:..::|.||||:..|     .|
  Rat    96 GQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMTVTVQNLFPNLQVFPALGNHDYWP-----QD 155

  Fly   345 EIPSSLRVDWLYEHVWSLWSKWLPAEAEETVLRGGYYT--ASPSKGHRIVALNSMDCYLYNWWLF 407
            ::|  :....:|..|..||..||..||..|:.:||:|:  .:.:...||::||:.        |:
  Rat   156 QLP--IATSKVYSAVSDLWKPWLDEEAISTLRKGGFYSQKVASNPDLRIISLNTN--------LY 210

  Fly   408 Y-------NATLIQEQLQWFHDTLLSAEEAGESVHILTHIPAGDGDCWCNWS-------QEYNR- 457
            |       |.|....|.:|..:||.|:....|.|:::.|:|.|    :..::       |.||. 
  Rat   211 YGPNIMTLNKTDPANQFEWLENTLNSSLRNKEKVYVIAHVPVG----YLPYATKTPAMRQYYNEK 271

  Fly   458 ---VLTRFNGIITGVFSGHTHKDEMNLHYSEDG-------YATVVNWNGGSLTSYSNKNPNYRLY 512
               :..|::.:|.|.|.||||:|.:.:...::|       .|..|....|.|...:| ||..||:
  Rat   272 LVDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPINSVFVAPAVTPVKGVLEKETN-NPGVRLF 335

  Fly   513 ELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEY-TEDTSPAGIDRLLLEMA--EKP 574
            :..|.::.:||...|..|||||||..:.  .|.|||..|:.| ..|..|..:..|..::|  :..
  Rat   336 QYKPGDYTLLDMLQYYLNLTEANLKGES--NWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSK 398

  Fly   575 DLLRKFWRNKFTNSDPKLAEGCDNACLSKTICRI 608
            ..| |::...|.:.|.  :..||..|.:..||.|
  Rat   399 QFL-KYYHYFFVSYDS--SAPCDQRCKTLQICAI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 91/321 (28%)
Metallophos 271..477 CDD:278574 65/227 (29%)
Smpdl3aNP_001005539.1 MPP_ASMase 37..333 CDD:277321 91/321 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53732
OrthoDB 1 1.010 - - D1142100at2759
OrthoFinder 1 1.000 - - FOG0000551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.