DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2218 and UFD2

DIOPT Version :9

Sequence 1:NP_001287613.1 Gene:CG2218 / 43611 FlyBaseID:FBgn0039767 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_010091.2 Gene:UFD2 / 851337 SGDID:S000002349 Length:961 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:50/224 - (22%)
Similarity:84/224 - (37%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EIVFDFPKAVDMKVIKL-WPSCGALR-----STAFELHGRHDGIWERVAFVRDLGRGVDSVTFCY 112
            |||:.....::..:..| .|.||.|:     |.:|.              .:||.:.:.:|..  
Yeast   763 EIVYRLASMLNYNLESLVGPKCGELKVKDPQSYSFN--------------PKDLLKALTTVYI-- 811

  Fly   113 QSDYNSRSSSNSEQSEKVFFFKSAHKILASTNSVKVVIRATERCPPVLRKVQMWGLPARSLDKAD 177
                     :.|||||   |..:..|...|.|. .:.:||.:             :..|....|.
Yeast   812 ---------NLSEQSE---FISAVAKDERSFNR-NLFVRAVD-------------ILGRKTGLAS 850

  Fly   178 RELVKTIWSEISDPYGQRDAAQTPTGQRSPPRNVPELRDQSTLSIPEEFLDSITWELMIFPTVLP 242
            .|.::.:.:..:....||.|              .|..|.....:|:||||.:.:.:|..|.:||
Yeast   851 PEFIEKLLNFANKAEEQRKA--------------DEEEDLEYGDVPDEFLDPLMYTIMKDPVILP 901

  Fly   243 SGKV-VDQSTIDKHAEEEAKWGRQPSDPF 270
            :.|: :|:|||..|...::      :|||
Yeast   902 ASKMNIDRSTIKAHLLSDS------TDPF 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2218NP_001287613.1 U-box 222..300 CDD:252675 18/50 (36%)
UFD2NP_010091.2 UFD2 1..961 CDD:227444 50/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.