DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2218 and Ube4b

DIOPT Version :9

Sequence 1:NP_001287613.1 Gene:CG2218 / 43611 FlyBaseID:FBgn0039767 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006239449.1 Gene:Ube4b / 298652 RGDID:1304738 Length:1388 Species:Rattus norvegicus


Alignment Length:323 Identity:69/323 - (21%)
Similarity:115/323 - (35%) Gaps:117/323 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 STAFELHGRHDGIWERVA--------------FVRDLGRGVDSVTFCY----------------- 112
            ||.|:      .:|:.:|              |||.:...::..||..                 
  Rat  1083 STIFK------SLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEM 1141

  Fly   113 ----QSDYNSRSSSNSEQSEKVFFFKSAHKILA-STNSVKVVIRATERC-PPVLRK--------- 162
                |.|...|....:.||:.....:.:...|| :|.:|.:....|::. .|.||.         
  Rat  1142 KNQEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHLLTKQVQKPFLRPELGPRLAAM 1206

  Fly   163 -----VQMWGLPARSLDKADRELV----KTIWSEISDPYGQRDAAQ----TPTGQRSPPRN---- 210
                 .|:.|...|.|...:.|..    |.:..:::|.|.|.|.|:    ....|||..:.    
  Rat  1207 LNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEE 1271

  Fly   211 -VPELRD---QSTLSI---------------------------PEEFLDSITWELMIFPTVLPSG 244
             :.::|.   :||::|                           |:||.|.:...||..|..||||
  Rat  1272 VISKMRKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSG 1336

  Fly   245 KVVDQSTIDKHAEEEAKWGRQPSDPFTGLEFNAQ--RKAILHLA--LKARIEKFLME--NSEH 301
            .::|:|.|.:|..      ..|:||     ||.|  .:::|...  ||.:|:.::.|  :|:|
  Rat  1337 TIMDRSIILRHLL------NSPTDP-----FNRQMLTESMLEPVPELKEQIQAWMREKQSSDH 1388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2218NP_001287613.1 U-box 222..300 CDD:252675 27/110 (25%)
Ube4bXP_006239449.1 Ufd2P_core 677..1297 CDD:287392 41/219 (19%)
U-box 1314..1384 CDD:252675 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.