DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2218 and Ube4a

DIOPT Version :10

Sequence 1:NP_651790.1 Gene:CG2218 / 43611 FlyBaseID:FBgn0039767 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001333627.1 Gene:Ube4a / 140630 MGIID:2154580 Length:1085 Species:Mus musculus


Alignment Length:80 Identity:29/80 - (36%)
Similarity:43/80 - (53%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EEFLDSITWELMIFPTVLPSGKV-VDQSTIDKHAEEEAKWGRQPSDPF--TGLEFNAQRKAILHL 285
            :||||.|...||..|.||||.:| ||:|||.:|...:      .:|||  :.|..:..|.   :.
Mouse  1009 DEFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHLLSD------QTDPFNRSPLTMDQIRP---NT 1064

  Fly   286 ALKARIEKFLMENSE 300
            .||.:|:::|.|..:
Mouse  1065 ELKEKIQRWLAERKQ 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2218NP_651790.1 DUF5918 6..187 CDD:466039
RING-Ubox_RNF37 223..275 CDD:438322 23/53 (43%)
Ube4aNP_001333627.1 Ufd2P_core 349..990 CDD:463080
RING-Ubox_UBE4A 1009..1078 CDD:438319 29/77 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.