DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2218 and UBE4B

DIOPT Version :9

Sequence 1:NP_001287613.1 Gene:CG2218 / 43611 FlyBaseID:FBgn0039767 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_005263479.1 Gene:UBE4B / 10277 HGNCID:12500 Length:1353 Species:Homo sapiens


Alignment Length:404 Identity:86/404 - (21%)
Similarity:138/404 - (34%) Gaps:143/404 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VCEDGYTA-ANLVADDVEQLERGFMCFAVCKPPIEIVFDFPKAVDMKVIKLWPS----------C 74
            :|...|.. ..|||..||.:   ||.....:|..:..|:..:...:....|.||          .
Human   970 LCNQNYIRNPYLVAKLVEVM---FMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHT 1031

  Fly    75 GALR------------STAFELHGRHDGIWERVA--------------FVRDLGRGVDSVTFCY- 112
            ||..            ||.|:      .:|:.:|              |||.:...::..||.. 
Human  1032 GATSEFYDKFTIRYHISTIFK------SLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLD 1090

  Fly   113 --------------------QSDYNSRSSSNSEQSEKVFFFKSAHKILA-STNSVKVVIRATERC 156
                                |.|...|....:.||:.....:.:...|| :|.:|.:....|::.
Human  1091 ESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQV 1155

  Fly   157 -PPVLRK--------------VQMWGLPARSLDKADRELV----KTIWSEISDPYGQRDAAQ--- 199
             .|.||.              .|:.|...|.|...:.|..    |.:..:::|.|.|.|.|:   
Human  1156 QKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAK 1220

  Fly   200 -TPTGQRSPPRN-----VPELRD---QSTLSI---------------------------PEEFLD 228
             ....|||..:.     :.::|.   :||::|                           |:||.|
Human  1221 AIADDQRSYSKELFEEVISKMRKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRD 1285

  Fly   229 SITWELMIFPTVLPSGKVVDQSTIDKHAEEEAKWGRQPSDPFTGLEFNAQ--RKAILHLA--LKA 289
            .:...||..|..||||.::|:|.|.:|..      ..|:||     ||.|  .:::|...  ||.
Human  1286 PLMDTLMTDPVRLPSGTIMDRSIILRHLL------NSPTDP-----FNRQTLTESMLEPVPELKE 1339

  Fly   290 RIEKFLME--NSEH 301
            :|:.::.|  ||:|
Human  1340 QIQAWMREKQNSDH 1353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2218NP_001287613.1 U-box 222..300 CDD:252675 28/110 (25%)
UBE4BXP_005263479.1 Ufd2P_core 642..1262 CDD:287392 57/300 (19%)
U-box 1279..1350 CDD:252675 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.