DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and RSM18

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_010970.4 Gene:RSM18 / 856776 SGDID:S000000852 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:30/96 - (31%)
Similarity:42/96 - (43%) Gaps:19/96 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYEKDPQQCILCKHSIEPHYKNVKLLSQFQSPYTG 82
            :||..|   .|.|.|...|:..|:.....||.|               .|...::||::.:. ||
Yeast    62 MGRIHL---DRKYQANKNSNRNDIMKSGANPLE---------------FYARPRILSRYVTS-TG 107

  Fly    83 RIYGRHITGLCKRRQEQVEQAILRAQQCLLM 113
            ||..|.||||..:.|.::.:||.|.|...||
Yeast   108 RIQHRDITGLSAKNQRRLSKAIRRCQAIGLM 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 17/51 (33%)
RSM18NP_010970.4 Ribosomal_S18 93..138 CDD:395861 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - O PTHR13479
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.