DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and rps18

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_051081.1 Gene:rps18 / 844736 -ID:- Length:101 Species:Arabidopsis thaliana


Alignment Length:64 Identity:19/64 - (29%)
Similarity:34/64 - (53%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLMPGYHKDLDFLQDPKLFD 130
            |:|:.|:|:|.|. .|:|..|.:..:..::|..:..||.:|:...|:|       ||.:.|.|:
plant    30 YRNMSLISRFISE-QGKILSRRVNRVTLKQQRLITIAIKQARILSLLP-------FLNNQKQFE 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 13/45 (29%)
rps18NP_051081.1 rps18 1..86 CDD:177016 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - O PTHR13479
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.