powered by:
Protein Alignment mRpS18C and rps18
DIOPT Version :9
Sequence 1: | NP_524593.1 |
Gene: | mRpS18C / 43609 |
FlyBaseID: | FBgn0039765 |
Length: | 140 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_051081.1 |
Gene: | rps18 / 844736 |
-ID: | - |
Length: | 101 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 19/64 - (29%) |
Similarity: | 34/64 - (53%) |
Gaps: | 8/64 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 YKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLMPGYHKDLDFLQDPKLFD 130
|:|:.|:|:|.|. .|:|..|.:..:..::|..:..||.:|:...|:| ||.:.|.|:
plant 30 YRNMSLISRFISE-QGKILSRRVNRVTLKQQRLITIAIKQARILSLLP-------FLNNQKQFE 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003545 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101408 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13479 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.