DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and AT1G07210

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_172201.1 Gene:AT1G07210 / 837232 AraportID:AT1G07210 Length:261 Species:Arabidopsis thaliana


Alignment Length:105 Identity:24/105 - (22%)
Similarity:46/105 - (43%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IKNPYEKDPQQCILCKHSIE-PHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQ 108
            ::||.:.:.:..:..:..:: ..::||:.|:.|.:. .|.|..|..||:..:.|.::.:.|..|:
plant   154 MQNPRQNNSKSEVTTEEVLKNADFRNVRFLANFITE-AGIIIKRKQTGISAKAQRKIAREIKTAR 217

  Fly   109 QCLLMP--------------GYHKDLDF----LQDPKLFD 130
            ...|||              ..::|.||    |.|...||
plant   218 AFGLMPFTTMGTKAFQFGKTMENRDQDFEYEVLDDDDEFD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 12/52 (23%)
AT1G07210NP_172201.1 Ribosomal_S18 176..222 CDD:376453 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - O PTHR13479
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.