DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and Mrps18a

DIOPT Version :10

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_081044.1 Gene:Mrps18a / 68565 MGIID:1915815 Length:196 Species:Mus musculus


Alignment Length:100 Identity:30/100 - (30%)
Similarity:49/100 - (49%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GTVSRLYSAAPESSDLDLPIDIKNPYEKDPQQCILCKHSIEPH---YKNVKLLSQFQSPYTGRIY 85
            |.::....|.|         |..||    ..||.:|:.::: |   |::|.|||||..||.|.: 
Mouse    51 GRITETPKATP---------DPPNP----SGQCPICRWNLK-HKYTYEDVLLLSQFIRPYGGML- 100

  Fly    86 GRHITGLCKRRQEQVEQAILRAQQCLLMPGYHKDL 120
            .|.:||||:....::|:.:..|.:..|:|.:...|
Mouse   101 PRRVTGLCREEHRKIEECVKMAHRAGLLPNHRPQL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 63..113 CDD:460054 18/52 (35%)
Mrps18aNP_081044.1 Ribosomal_S18 83..128 CDD:460054 17/45 (38%)

Return to query results.
Submit another query.