DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mrps18c

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001038655.2 Gene:mrps18c / 569841 ZFINID:ZDB-GENE-060503-609 Length:136 Species:Danio rerio


Alignment Length:95 Identity:48/95 - (50%)
Similarity:69/95 - (72%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PESSDLDLPIDIKNPYEKDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQE 98
            |.|.| |:||.::|||::..:.||||..:::  :|||:|||||.||:|||||||||||||.|:|:
Zfish    38 PASKD-DMPIKMENPYKQPAKTCILCNVTVD--FKNVQLLSQFISPHTGRIYGRHITGLCGRKQK 99

  Fly    99 QVEQAILRAQQCLLMPGYHKDLDFLQDPKL 128
            :|.:||.:::....|....||..|:|||.:
Zfish   100 EVTKAIKKSRSMGFMSVTLKDPLFIQDPDI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 28/51 (55%)
mrps18cNP_001038655.2 Ribosomal_S18 63..114 CDD:279431 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10180
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9371
Inparanoid 1 1.050 94 1.000 Inparanoid score I5060
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592020at2759
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 1 1.000 - - oto41215
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - LDO PTHR13479
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3914
SonicParanoid 1 1.000 - - X5181
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.