DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and MRPS18A

DIOPT Version :10

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_006715197.1 Gene:MRPS18A / 55168 HGNCID:14515 Length:270 Species:Homo sapiens


Alignment Length:82 Identity:25/82 - (30%)
Similarity:43/82 - (52%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAAPESSDLDLPIDIKNPYEKDPQ-QCILCKHSIEP--HYKNVKLLSQFQSPYTGRIYGRHITGL 92
            :|.|:.|          |...:|. ||.:|:.:::.  :|.:|.|||||..|:.|.: .|.||||
Human    54 TATPKES----------PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGML-PRKITGL 107

  Fly    93 CKRRQEQVEQAILRAQQ 109
            |:....::|:.:..|.:
Human   108 CQEEHRKIEECVKMAHR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 63..113 CDD:460054 17/49 (35%)
MRPS18AXP_006715197.1 Ribosomal_S18 78..126 CDD:460054 17/48 (35%)

Return to query results.
Submit another query.