DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and MRPS18A

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_006715197.1 Gene:MRPS18A / 55168 HGNCID:14515 Length:270 Species:Homo sapiens


Alignment Length:82 Identity:25/82 - (30%)
Similarity:43/82 - (52%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAAPESSDLDLPIDIKNPYEKDPQ-QCILCKHSIEP--HYKNVKLLSQFQSPYTGRIYGRHITGL 92
            :|.|:.|          |...:|. ||.:|:.:::.  :|.:|.|||||..|:.|.: .|.||||
Human    54 TATPKES----------PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGML-PRKITGL 107

  Fly    93 CKRRQEQVEQAILRAQQ 109
            |:....::|:.:..|.:
Human   108 CQEEHRKIEECVKMAHR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 17/51 (33%)
MRPS18AXP_006715197.1 Ribosomal_S18 78..126 CDD:279431 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.