DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mrps18b

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001017759.1 Gene:mrps18b / 550455 ZFINID:ZDB-GENE-050417-278 Length:242 Species:Danio rerio


Alignment Length:77 Identity:26/77 - (33%)
Similarity:44/77 - (57%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EKDPQQCILCKH-SIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLM 113
            :|....|.:|:. :|..|||||.||.||..|.||.::...:||:|.::|:.:.:||..|:...|:
Zfish   113 KKCANPCPICRDPNIIIHYKNVNLLQQFFCPETGVVHDPTVTGVCMKQQKLLSKAIETAKDFGLL 177

  Fly   114 PGYHKDLDFLQD 125
            ......:||.::
Zfish   178 RAQFAHVDFTKE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 20/52 (38%)
mrps18bNP_001017759.1 Ribosomal_S18 126..177 CDD:279431 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.