DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mrps18c

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001017092.2 Gene:mrps18c / 549846 XenbaseID:XB-GENE-952459 Length:131 Species:Xenopus tropicalis


Alignment Length:92 Identity:48/92 - (52%)
Similarity:66/92 - (71%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLPIDIKNPYEKDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAI 104
            |:|..::|||:..|::||||..:::  |||.:|||||.||:||.|:||||||||.|:|..|.:||
 Frog    42 DMPQQMENPYKDPPKKCILCGVTVD--YKNTQLLSQFISPHTGHIFGRHITGLCGRKQRAVSKAI 104

  Fly   105 LRAQQCLLMPGYHKDLDFLQDPKLFDP 131
            .||.....||..:||..||:|||:.:|
 Frog   105 KRAHIMGFMPVTYKDPAFLKDPKICEP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 28/51 (55%)
mrps18cNP_001017092.2 Ribosomal_S18 63..113 CDD:279431 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9371
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592020at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13479
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3914
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.