DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mRpS18A

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:57/147 - (38%) Gaps:39/147 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLAQNATLVNLVGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYEKDPQQ---------------- 55
            |:.|.||      |....|::::...|     ..:|..||..:||....                
  Fly     3 FVLQLAT------RTVRSTIAQVRGVA-----TTMPRQIKEIHEKQENSVKIFEGVNVESPRAHL 56

  Fly    56 ----------CILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQC 110
                      |..|...::..:.:|.:|||:... .|.:..|.|||||.|:|:::...:..||:.
  Fly    57 MLKSACQTKFCPECTLGLDIKHTDVLILSQYVRS-DGCMLPRRITGLCHRQQKKMGTLVTMAQKA 120

  Fly   111 LLMPGYHKDLDFLQDPK 127
            .|||....:.. .:|||
  Fly   121 GLMPNLAPEWS-KRDPK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 15/51 (29%)
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13479
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.