DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and rsm18

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_587934.1 Gene:rsm18 / 2538921 PomBaseID:SPCC18B5.04 Length:166 Species:Schizosaccharomyces pombe


Alignment Length:128 Identity:38/128 - (29%)
Similarity:59/128 - (46%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KFLAQNATLVNLVG--RQQLGTVSRLYSAAPESSDLDLPIDI-------KNP---YEKDPQQCIL 58
            ||..:|:...:.||  |:....:....||:.|..|:..|.|:       ||.   ||...:.|..
pombe    36 KFNERNSEASSNVGFQRRVRSNIPSYLSASVEEGDIYSPNDLLFETVKAKNQAKFYEPVREDCFK 100

  Fly    59 CKHSIEPHY-KNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLMPGYHKDL 120
            ..:....:| ||..:||:|.:. .|||..|..|||..:.|..:.:||.||:...:||..:|.:
pombe   101 TVNENPMNYWKNPVILSRFVTE-LGRIKPRGDTGLTAKNQRLLSRAIRRARAAGIMPTKYKSV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 18/52 (35%)
rsm18NP_587934.1 RpsR <99..143 CDD:223316 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - O PTHR13479
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.