DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mrps-18.C

DIOPT Version :9

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_495374.2 Gene:mrps-18.C / 188492 WormBaseID:WBGene00020499 Length:139 Species:Caenorhabditis elegans


Alignment Length:137 Identity:55/137 - (40%)
Similarity:86/137 - (62%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAQNATLVNLVGRQQ---LGTVSRLYSAAPESSDLDLPIDIK-NPYEKDPQQCILCKHSIEPHYK 68
            |...::||....|.|   |.:.|.....:|..|..|.|:.:: |||.|:|::|:||...:|..||
 Worm     2 LKSASSLVRSFIRPQTFRLCSSSSTTQGSPSVSSDDEPVILENNPYTKEPRKCLLCSTGVELDYK 66

  Fly    69 NVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLMPGYHKDLDFLQDPKLFDPER 133
            |.:||.||.|.::||:|.|||||||...::::.:||.::::...||.:.||..:.:|||||||.:
 Worm    67 NSRLLQQFVSTFSGRVYDRHITGLCDENKKKLIEAIAKSRRAGFMPIFVKDPKYTRDPKLFDPLK 131

  Fly   134 PVRPHKY 140
            |:|||.:
 Worm   132 PIRPHSF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 61..113 CDD:279431 21/51 (41%)
mrps-18.CNP_495374.2 Ribosomal_S18 61..111 CDD:279431 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165950
Domainoid 1 1.000 50 1.000 Domainoid score I7894
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9371
Inparanoid 1 1.050 109 1.000 Inparanoid score I3460
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29160
OrthoDB 1 1.010 - - D1592020at2759
OrthoFinder 1 1.000 - - FOG0003545
OrthoInspector 1 1.000 - - oto19040
orthoMCL 1 0.900 - - OOG6_101408
Panther 1 1.100 - - LDO PTHR13479
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3914
SonicParanoid 1 1.000 - - X5181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.