DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18C and mrps-18A

DIOPT Version :10

Sequence 1:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_498835.1 Gene:mrps-18A / 176176 WormBaseID:WBGene00022583 Length:183 Species:Caenorhabditis elegans


Alignment Length:59 Identity:22/59 - (37%)
Similarity:37/59 - (62%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KDPQQCILCKHS--IEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRA 107
            ||.:.|.||..:  |:..||:|.:|.||... .|.:..|.:|||||::|.::|:.:::|
 Worm    63 KDDELCSLCTCNVPIKLTYKDVLILEQFMRD-DGTVLPRQLTGLCKKQQLRMERCVMQA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18CNP_524593.1 Ribosomal_S18 63..113 CDD:460054 17/45 (38%)
mrps-18ANP_498835.1 Ribosomal_S18 77..120 CDD:460054 16/43 (37%)

Return to query results.
Submit another query.