DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdc and cri-1

DIOPT Version :9

Sequence 1:NP_788768.1 Gene:hdc / 43604 FlyBaseID:FBgn0010113 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_001379194.1 Gene:cri-1 / 187082 WormBaseID:WBGene00010614 Length:346 Species:Caenorhabditis elegans


Alignment Length:316 Identity:84/316 - (26%)
Similarity:146/316 - (46%) Gaps:50/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 PQQQQQQQQSLLIQPLGPAFGSNLLQNGLGLSKNLLIAPQQQQQQQLQQQQQQQNNLPALANISN 406
            |.......|.:|::|                  .||.|.....|||....:::.|.|  ::|.|:
 Worm    53 PDDDNYDSQLMLLKP------------------TLLAAATAANQQQNYDFRKRSNTL--MSNRSD 97

  Fly   407 FK-PLASYEQQ---------QLVQQQKNKEVELYSDRVRSTSGCNG-IFSRRLDFSS-FNLLPKT 459
            .: |......|         ::::...:::.....:.||    .|| :|.:|.|::: .:::|::
 Worm    98 KRWPKRDMGPQFELRCCIDPEILRINVDRQYYFEDETVR----VNGSVFHKRSDYNNLLSVIPRS 158

  Fly   460 RLNSYQVKIEDEGNHGNDETRLFILSSLAQSQMSRVACILCEEPLLVFDRYPLVDGSFFLSPKQH 524
            :.|...:|:||:...|.|:.||.:|.||....:..:.|:.|::.|.|:|:|||:||.|::||...
 Worm   159 KFNGIHIKMEDDCPQGGDDVRLCLLKSLGAHNLRAIPCVQCKDELKVYDKYPLIDGVFYISPVSQ 223

  Fly   525 SSGCIEVKYEGRTLYLTCVCMSCLDGTSSSRAINCRFC-KEPW-DGSSLVLGTMYAYDIFAAMPC 587
            .....|:..:||..||..:|..||....|     |:.| |:.| ||.|.||||:|.|||.::..|
 Worm   224 FGPKTEISLDGRRFYLQQLCARCLWSDWS-----CKNCGKDEWFDGKSFVLGTLYYYDIVSSGRC 283

  Fly   588 CAERFKCNNCFKML-----MHPQQRLSFYSDYSHGVTCPYCNTQDTHFVKPLTFCY 638
            |.  ..|.:|.:.|     :..|.....|:..:..:.|..|...:.|.|:.:..|:
 Worm   284 CP--VVCQSCRQSLGVRDQLATQLANGNYATINEQMACQSCGVSNFHLVRDIKTCH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hdcNP_788768.1 HECA 69..172 CDD:291998
Headcase 444..634 CDD:292621 63/197 (32%)
cri-1NP_001379194.1 Headcase 138..331 CDD:406412 64/199 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164199
Domainoid 1 1.000 117 1.000 Domainoid score I3698
eggNOG 1 0.900 - - E1_KOG3816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008043
OrthoInspector 1 1.000 - - oto20130
orthoMCL 1 0.900 - - OOG6_109261
Panther 1 1.100 - - LDO PTHR13425
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3611
SonicParanoid 1 1.000 - - X6000
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.