DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and gzma

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:266 Identity:75/266 - (28%)
Similarity:117/266 - (43%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIERE 217
            |..|.    |..|:|.. ....|||.::..:      :..|.|.||::.:|||||||        
Zfish    23 CSDVS----IVGGKDVK-KALSWMVSIQVNQ------NHKCGGILIHKEWVLTAAHC-------- 68

  Fly   218 VGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNV 282
                      :.|:.::|....|..|.|...||:......:.|.:::|....  ||.|||:.:.|
Zfish    69 ----------KEDSYSSVTVLIGSLSLSKGSQRIAIHNYEIPETFNKKTKKD--DIMLIRLSKKV 121

  Fly   283 RYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVK--QKVTVNYVDPAKCRQRFSQI 345
            :    .:|..:|...  :..|.|.:..|.|||.|....:.|..  |.:.|..||..:|.:.:::.
Zfish   122 K----AKPYKIPKKE--KDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRN 180

  Fly   346 KVNLEPTQLCAGG-QFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYD 409
            .| :....||||. |..:.:|.|||||||...::    |.|::|..:.||....|.|||.::...
Zfish   181 PV-ITKDMLCAGNTQQHRGTCLGDSGGPLECEKN----LVGVLSGSHGCGDPKKPTVYTLLSKRH 240

  Fly   410 I-WIRQ 414
            | ||.:
Zfish   241 ITWINK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 71/254 (28%)
Tryp_SPc 162..415 CDD:238113 73/257 (28%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.